General Information

  • ID:  hor000191
  • Uniprot ID:  P56688
  • Protein name:  Mandibular organ-inhibiting hormone
  • Gene name:  NA
  • Organism:  Libinia emarginata (Portly spider crab)
  • Family:  Arthropod CHH/MIH/GIH/VIH hormone family
  • Source:  Animal
  • Expression:  Produced by the medulla terminalis X-organ in the eyestalks and transported to the sinus gland where it is stored and released.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Libinia (genus), Majidae (family), Majoidea (superfamily), Heterotremata, Eubrachyura, Brachyura (infraorder), Pleocyemata (suborder), Decapoda (order), Eucarida (superorder), Eumalacostraca (subclass), Malacostraca (class), Multicrustacea (superclass), Crustacea (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  QIFDPSCKGLYDRGLFSDLEHVCKDCYNLYRNPQVTSACRVNCYSNRVFRQCMEDLLLMEDFDKYARAIQTV
  • Length:  72(63-134)
  • Propeptide:  MTTKCTVMAVVLAACICLQVLPQAYGRSTQGYGRMDKLLATLMGSSEGGALESASQHSLEKRQIFDPSCKGLYDRGLFSDLEHVCKDCYNLYRNPQVTSACRVNCYSNRVFRQCMEDLLLMEDFDKYARAIQTVGKK
  • Signal peptide:  MTTKCTVMAVVLAACICLQVLPQAYG
  • Modification:  T1 Pyrrolidone carboxylic acid;T72 Valine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Represses the synthesis of methyl farnesoate, the precursor of insect juvenile hormone III in the mandibular organ. Also has hyperglycemic activity.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  7-43; 23-39; 26-52
  • Structure ID:  AF-P56688-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor000191_AF2.pdbhor000191_ESM.pdb

Physical Information

Mass: 977733 Formula: C370H571N103O112S8
Absent amino acids: W Common amino acids: DLCR
pI: 5.76 Basic residues: 10
Polar residues: 23 Hydrophobic residues: 21
Hydrophobicity: -38.89 Boman Index: -16437
Half-Life: 0.8 hour Half-Life Yeast: 10 min
Half-Life E.Coli: >10 hour Aliphatic Index 73.06
Instability Index: 3701.25 Extinction Coefficient cystines: 7825
Absorbance 280nm: 110.21

Literature

  • PubMed ID:  9783445
  • Title:  cDNA Cloning of a Mandibular Organ Inhibiting Hormone From the Spider Crab Libinia Emarginata.
  • PubMed ID:  9299429
  • Title:  A Neurohormone Regulating Both Methyl Farnesoate Synthesis and Glucose Metabolism in a Crustacean.